PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00021.111
Common NameAMTR_s00021p00158020, LOC18442220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family TCP
Protein Properties Length: 376aa    MW: 41164.7 Da    PI: 9.4427
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00021.111genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP121.31.2e-37251342115
                                       TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70 
                                               +g+kdrhsk++T++g+RdRRvRlsa++a++f+d+qd+LG+d++sk+++WL+++akpai+el+++++ ++
  evm_27.model.AmTr_v1.0_scaffold00021.111  25 TGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDVQDRLGYDRPSKAVDWLIKKAKPAIDELAELPAWQP 93 
                                               79**************************************************************55555 PP

                                       TCP  71 seceaesssssasnsssgkaaksaakskksqksaasalnlakesr 115
                                               +++    + ++ +n++ ++ + +++  ++s+++++ ++nl+++++
  evm_27.model.AmTr_v1.0_scaffold00021.111  94 TAA----NLQNPHNKEVAEPSVTKTRARSSSSPKTITQNLSHSHS 134
                                               222....12222222222333333333333333333444444332 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.3E-3325135IPR005333Transcription factor, TCP
PROSITE profilePS5136934.5432785IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MGERRGGNTV GEIVEVEGGH IVRSTGRKDR HSKVCTAKGP RDRRVRLSAH TAIQFYDVQD  60
RLGYDRPSKA VDWLIKKAKP AIDELAELPA WQPTAANLQN PHNKEVAEPS VTKTRARSSS  120
SPKTITQNLS HSHSTSIAAQ SNPPSSFLLP PMETETMKPF SSSASSSSVG FLNQVQNYPP  180
DLLSRSNSQE LRLSLQSLHD PHHQQMHPIL IQPPAQNPAL QAGIFRFSNE NPLPIHGEQG  240
LFWSEQHHPE FGAARFQRVV AWNSDPSSSS SSSIGFVNSR DVFNSNQSPI IPSFGHHSSF  300
TKQRGPLQSS HYLPIRAREL PPVNNQMASD MPMVSSGFSS GGFSGFRIPA RIQGEEEEHD  360
GVTETSAAAS TSRHP*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00009PBMTransfer from 929286Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011626273.10.0PREDICTED: transcription factor TCP4
SwissprotQ8LPR54e-73TCP4_ARATH; Transcription factor TCP4
TrEMBLW1PVB30.0W1PVB3_AMBTC; Uncharacterized protein
STRINGPOPTR_0001s38480.15e-85(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18015163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15030.32e-66TCP family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]